PNC27 Kit

Price range: $133.00 through $227.00

Description

🧪 Product Profile: PNC27

Product Name: PNC27 peptide
CAS Numbers: 392661-17-5; 1159861-00-3
Category: Anticancer peptide; research-grade bioactive compound
Form: Lyophilized white powder for laboratory use
Molecular Formula: C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular Weight: 4032.13 g/mol
Purity: ≥98% (HPLC); single impurity ≤2%

🔬 Mechanism of Action

PNC27 exerts selective anticancer activity through a dual-domain structure:

  • HDM-2 Binding Domain: Corresponding to residues 12-26 of the tumor suppressor protein p53, enabling specific recognition of membrane-bound HDM-2 (a p53-negative regulator overexpressed on cancer cells).
  • Transmembrane-Penetrating Domain: Facilitates insertion into cancer cell membranes, inducing membranolysis (physical disruption of lipid bilayers) while sparing normal cells lacking surface HDM-2.

🧫 Key Properties

  • Amino Acid Sequence (1-letter code):
    PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
  • Solubility: Highly soluble in aqueous buffers (PBS, water for injection); slightly soluble in ethanol
  • Storage Stability:
    • Lyophilized form: -20°C to -80°C for 24 months (desiccated, protected from light)
    • Reconstituted solution: Use within 24 hours or aliquot and freeze at -80°C
  • Physical Characteristics: Amorphous powder; endotoxin level ≤50 EU/mg

🩺 Preclinical Research Applications

PNC27 demonstrates efficacy across multiple cancer models:

  • Solid Tumors: Pancreatic cancer, breast cancer, melanoma, and glioblastoma (in vitro and xenograft studies)
  • Hematological Malignancies: Leukemia cell lines (e.g., K562, Jurkat)
  • Mechanistic Studies: Investigation of HDM-2 membrane localization as a cancer-specific biomarker

⚙️ Handling & Experimental Use

  • Reconstitution: Dissolve in sterile water or 0.9% saline to working concentrations (typically 1-10 mg/mL)
  • Administration Routes: Intratumoral injection, intravenous infusion, or cell culture supplementation
  • Dosing Considerations:
    • In vitro: 5-50 μM for cancer cell viability assays
    • In vivo: 0.1-1 mg/kg in murine models (adjust based on tumor type)

📌 Supplier Specifications

  • Packaging: 1mg, 10mg, 50mg, or custom vials (vacuum-sealed under nitrogen)
  • Quality Control:
    • Peptide content ≥75% (amino acid analysis)
    • Moisture ≤10% (Karl Fischer method)
    • Sterility: Aseptically filtered (0.22 μm) for cell culture use

Additional information

FORMAT

10Bottlex5mg, 10Bottlex10mg

Frequently Asked Questions

USP Grade MCT oil is the carrier oil. The only solvents used are Benzyl Alcohol & Benzyl Benzoate (BA & BB).
None of our HGH lines are inherently better than the other. Each batch comes with a corresponding test report. Purity and dimer can be a decent proxy for “quality”, you want purity as high as possible and dimer as low as possible. The main factor to consider in our opinion, is the price per IU. Supreme is usually the best bang for buck option. Historically, Supreme & Deluxe have shown lower dimer content, although this may not always be the case, so of course reference the corresponding test reports.
For HGH, we typically recommend 1ml for every ~10 IU in the vial. If a batch tests at an average of 290 IU per kit, that is an average of 29 IU per vial, and we’d recommend 2.9ml of bacteriostatic water. This will make the syringe math similar to a traditional 100 iu kit with 1ml of solution For peptide reconstituion, you can use our amazing Dosage Calculator.
No, you must purchase it seperately .
Not necessarily. If you look through all our lab reports, particularly the ones with multiple test reports in a single batch, you will see that the intra-batch variance can actually be quite high. When you purchase a batch, you can expect some of the vials in your kit to be as much as 5-15% +/- whatever the corresponding lab test reflects. This is simply the reality of product that is not made to the same standards as pharmaceutical grade growth hormone. To state otherwise would be disingenous. There can also be a high variance in the dimer content intra-batch. (For Example: Economy B, Deluxe A, etc) Over time, we’ve increased the volume of samples analyzed for each batch, to provide more transparancy regarding the potential for intra-batch variance. If you use the average IU figure provided on each product, your dosage should average out over time, so don’t overthink your administration protocol too much. We know it can be a bit overwhelming with all the different numbers provided. That said, don’t hesitate to reach out if you need specific guidance on dosage or reconstitution.
Yes! We offer store credit for quantitative testing of total IU/Purity (ie Janoshik testing), and for personal IGF-1 test results. Please email for more information. *TERMS APPLY*
Mainly Bitcoin, if needed PayPal, Alibaba Credit Insurance Order and Bank Transfer. Please send us an email, or contact us via Whats App.
Depending on your location, most customers receive their order in 2-10 business days. We ship with USPS Ground Shipping, from the United States only. 99% of orders ship within 24 hours (excluding weekends & holidays)
We are no longer providing tracking. If your order is over 10 business days old and hasn’t arrived, our customer service team can check your tracking information to see the status of your package
If your order was marked as “completed”, typically this means a label has been generated and your order is scheduled to go out that day or the next. “Processing” status orders have not been shipped, processing means payment has been confirmed successfully. Don’t hesitate to reach out regarding the status of your order.
Unfortunately we do not provide reships for incorrect addresses. In the VERY rare instance that a package is lost in transit, we will reship your order free of charge.
Yes. If you need more information or have a specific request, please email us.
WhatsApp Email