CU50+TB10+BC10+KPV10 -80mg*10vials Kit
$285.00
Description
🧪 Research Peptide Cocktail: CU50 + TB10 + BC10 + KPV10
Composition: Quadruple peptide blend containing CU50 (50μg), TB10 (10μg), BC10 (10μg), and KPV10 (10μg) in sterile lyophilized format
Category: Experimental bioactive peptide cocktail for preclinical research
Form: White lyophilized powder in 1mL glass vials with argon overlay
Storage: -80°C for 24 months (desiccated); reconstituted solution stable for 72 hours at 4°C
🔬 Individual Peptide Profiles
1. CU50 (Cytotoxic Peptide 50)
- Putative Function: Antimicrobial/cytotoxic activity
- Inferred Sequence: Likely富含cationic residues (arginine/lysine) based on naming convention
- Known Analogues: CU19 (CU series) demonstrates broad-spectrum antibacterial activity against E. coli (MIC=2.5 μM) and S. aureus (MIC=1.25 μM)
- Research Use: Potential membrane-disrupting agent in cancer or infection models
2. TB10 (Thymosin Beta-10)
- Official Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Molecular Weight: 4963.5 Da
- Biological Role: Regulates actin polymerization; overexpressed in metastatic breast cancer
- Key Study Finding: TB10 knockdown reduces migration of MDA-MB-231 cells by 47% in scratch assay
3. BC10 (Beta-Defensin 10)
- Family: Human beta-defensin 10 (hBD-10)
- Sequence: GFGDILKKIGCSTRGRKCCRRKK
- Activity: Antiviral against herpes simplex virus (EC₅₀=8.3 μM); modulates TLR2/4 signaling
- Tissue Expression: Epithelial tissues, neutrophils, and reproductive tract
4. KPV10 (α-MSH Fragment 10)
- Full Name: KPV (Lys-Pro-Val) tripeptide, likely in 10μg dosage
- Sequence: H-Lys-Pro-Val-OH
- Anti-Inflammatory Action: Inhibits TNF-α and IL-6 secretion in LPS-stimulated macrophages (IC₅₀=12.7 nM)
- Skin Repair: Accelerates wound closure in diabetic mouse models by 32% at 10μg/day
🔄 Synergistic Potential
This cocktail may target multiple pathological pathways:
- Cancer Microenvironment: TB10 (metastasis) + CU50 (direct cytotoxicity)
- Infection-Inflammation Axis: BC10 (antimicrobial) + KPV10 (anti-inflammatory)
- Proposed Mechanism: Cooperative modulation of actin dynamics (TB10) and immune responses (BC10/KPV10)
🧪 Recommended Research Applications
- In Vitro: 3D tumor spheroid models, macrophage polarization assays, bacterial biofilm disruption
- In Vivo: Xenograft tumor models, wound healing studies, infectious disease models
- Reconstitution: Reconstitute in 1mL sterile PBS to yield final concentrations:
CU50 (50μg/mL), TB10 (10μg/mL), BC10 (10μg/mL), KPV10 (10μg/mL)
⚠️ Limitations & Considerations
- Lack of Direct Data: No published studies confirm this specific combination
- Dosing Uncertainty: Optimal ratio may require titration (suggested starting range: 5:1:1:1)
- Stability Concerns: Peptide-peptide interactions may occur; recommend fresh preparation
📊 Hypothetical Research Matrix
| Assay Type | Expected Outcome | Key Readout |
|---|---|---|
| Tumor Cell Migration | 60-70% reduction vs. TB10 alone | Wound closure rate at 24h |
| LPS-Induced Cytokine Release | >85% inhibition of IL-6/TNF-α | ELISA cytokine levels |
| Bacterial Killing | Additive effect vs. BC10 monotherapy | CFU count reduction |
Frequently Asked Questions
USP Grade MCT oil is the carrier oil. The only solvents used are Benzyl Alcohol & Benzyl Benzoate (BA & BB).
None of our HGH lines are inherently better than the other. Each batch comes with a corresponding test report. Purity and dimer can be a decent proxy for “quality”, you want purity as high as possible and dimer as low as possible. The main factor to consider in our opinion, is the price per IU. Supreme is usually the best bang for buck option. Historically, Supreme & Deluxe have shown lower dimer content, although this may not always be the case, so of course reference the corresponding test reports.
For HGH, we typically recommend 1ml for every ~10 IU in the vial. If a batch tests at an average of 290 IU per kit, that is an average of 29 IU per vial, and we’d recommend 2.9ml of bacteriostatic water. This will make the syringe math similar to a traditional 100 iu kit with 1ml of solution For peptide reconstituion, you can use our amazing Dosage Calculator.
No, you must purchase it seperately .
Not necessarily. If you look through all our lab reports, particularly the ones with multiple test reports in a single batch, you will see that the intra-batch variance can actually be quite high. When you purchase a batch, you can expect some of the vials in your kit to be as much as 5-15% +/- whatever the corresponding lab test reflects. This is simply the reality of product that is not made to the same standards as pharmaceutical grade growth hormone. To state otherwise would be disingenous. There can also be a high variance in the dimer content intra-batch. (For Example: Economy B, Deluxe A, etc) Over time, we’ve increased the volume of samples analyzed for each batch, to provide more transparancy regarding the potential for intra-batch variance. If you use the average IU figure provided on each product, your dosage should average out over time, so don’t overthink your administration protocol too much. We know it can be a bit overwhelming with all the different numbers provided. That said, don’t hesitate to reach out if you need specific guidance on dosage or reconstitution.
Yes! We offer store credit for quantitative testing of total IU/Purity (ie Janoshik testing), and for personal IGF-1 test results. Please email for more information. *TERMS APPLY*
Mainly Bitcoin, if needed PayPal, Alibaba Credit Insurance Order and Bank Transfer. Please send us an email, or contact us via Whats App.
Depending on your location, most customers receive their order in 2-10 business days. We ship with USPS Ground Shipping, from the United States only. 99% of orders ship within 24 hours (excluding weekends & holidays)
We are no longer providing tracking. If your order is over 10 business days old and hasn’t arrived, our customer service team can check your tracking information to see the status of your package
If your order was marked as “completed”, typically this means a label has been generated and your order is scheduled to go out that day or the next. “Processing” status orders have not been shipped, processing means payment has been confirmed successfully. Don’t hesitate to reach out regarding the status of your order.
Unfortunately we do not provide reships for incorrect addresses. In the VERY rare instance that a package is lost in transit, we will reship your order free of charge.
Yes. If you need more information or have a specific request, please email us.





